PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G53200.1
Common NameAtMYB27, MYB27, T4D2.130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 238aa    MW: 27996.2 Da    PI: 7.0501
Description myb domain protein 27
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G53200.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13e-161158148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W +eEde+lv+++ +lG ++W++ a   g++R++k+c++rw +yl
      AT3G53200.1 11 RGPWLEEEDERLVKVISLLGERRWDSLAIVSGLKRSGKSCRLRWMNYL 58
                     89********************************************97 PP

2Myb_DNA-binding54.13.5e-1764108147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++++eE+ ++ ++++++G++ W++Iar+++ gRt++++k++w+++
      AT3G53200.1  64 RGPMSQEEERIIFQLHALWGNK-WSKIARRLP-GRTDNEIKNYWRTH 108
                      89********************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.661658IPR017930Myb domain
SuperFamilySSF466892.76E-279105IPR009057Homeodomain-like
SMARTSM007173.7E-131060IPR001005SANT/Myb domain
PfamPF002492.6E-141158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-191265IPR009057Homeodomain-like
CDDcd001673.48E-81358No hitNo description
PROSITE profilePS5129427.15759113IPR017930Myb domain
SMARTSM007176.0E-1763111IPR001005SANT/Myb domain
PfamPF002491.9E-1564108IPR001005SANT/Myb domain
CDDcd001671.38E-1066108No hitNo description
Gene3DG3DSA:1.10.10.604.4E-2466112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0010200Biological Processresponse to chitin
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MDFKKEETLR RGPWLEEEDE RLVKVISLLG ERRWDSLAIV SGLKRSGKSC RLRWMNYLNP  60
TLKRGPMSQE EERIIFQLHA LWGNKWSKIA RRLPGRTDNE IKNYWRTHYR KKQEAQNYGK  120
LFEWRGNTGE ELLHKYKETE ITRTKTTSQE HGFVEVVSME SGKEANGGVG GRESFGVMKS  180
PYENRISDWI SEISTDQSEA NLSEDHSSNS CSENNINIGT WWFQETRDFE EFSCSLWS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-2991122104MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-28911256158MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-28911256158MYB PROTO-ONCOGENE PROTEIN
1mse_C5e-2991122104C-Myb DNA-Binding Domain
1msf_C5e-2991122104C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible251974_at0.0
Expression AtlasAT3G53200-
AtGenExpressAT3G53200-
ATTED-IIAT3G53200-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00406DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G53200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G53200
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1172560.0AK117256.1 Arabidopsis thaliana At3g53200 mRNA for putative transcription factor (MYB27), complete cds, clone: RAFL16-81-D10.
GenBankAY5195990.0AY519599.1 Arabidopsis thaliana MYB transcription factor (At3g53200) mRNA, complete cds.
GenBankBT0052570.0BT005257.1 Arabidopsis thaliana At3g53200 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_566980.11e-176myb domain protein 27
TrEMBLQ9SCP11e-176Q9SCP1_ARATH; At3g53200
STRINGAT3G53200.11e-175(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM113972533
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Van Hoewyk D, et al.
    Overexpression of AtCpNifS enhances selenium tolerance and accumulation in Arabidopsis.
    Plant Physiol., 2005. 139(3): p. 1518-28
    [PMID:16244144]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
    Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor.
    Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11
    [PMID:17722694]
  6. Velten J,Cakir C,Youn E,Chen J,Cazzonelli CI
    Transgene silencing and transgene-derived siRNA production in tobacco plants homozygous for an introduced AtMYB90 construct.
    PLoS ONE, 2012. 7(2): p. e30141
    [PMID:22363419]